Cat. No.: IBDP-531710
Size:
Online InquiryTarget Information
| Sequence | MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARP VKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENG TDDSAASSSL |
| Sequence Similarities | Contains 1 B box-type zinc finger. Contains 1 B30. 2/SPRY domain. Contains 1 DAPIN domain. |
| Amino Acids | 1 to 110 |
| Cellular Localization | Nucleus and Cytoplasm > cytoskeleton. Associated with microtubules and with the filamentous actin of perinuclear filaments and peripheral lamellar ruffles. |
| Tissue Specificity | Expressed in peripheral blood leukocytes, particularly in mature granulocytes and to a lesser extent in monocytes but not in lymphocytes. Detected in spleen, lung and muscle, probably as a result of leukocyte infiltration in these tissues. Not expressed in thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, liver, kidney, pancreas. Expression detected in several myeloid leukemic, colon cancer, and prostate cancer cell lines. |
| Function | Probably controls the inflammatory response in myelomonocytic cells at the level of the cytoskeleton organization. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Tag | GST |
| Protein Length | Protein fragment |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |