Recombinant Human RANKL Protein

Target Information

Sequence	LDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTF SNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPS SHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDP DQDATYFGAFKVRDID
Sequence Similarities	Belongs to the tumor necrosis factor family.
Amino Acids	152 to 317
Cellular Localization	Cytoplasm. Secreted and Cell membrane.
Tissue Specificity	Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
Function	Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Tag	DDDDK Tag
Endotoxin Level	<0.1 Eu/μg
Protein Length	Protein fragment
Molecular Weight	18 kDa
Purity	>90%
Active	Yes
Animal free	No
Nature	Recombinant
Application	ELISA, FuncS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.