Cat. No.: IBDP-530101
Size:
Online InquiryTarget Information
| Sequence | EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRG WAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYV TKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIE VSNPSLLDPDQDATYFGAFKVRDID |
| Sequence Similarities | Belongs to the tumor necrosis factor family. |
| Amino Acids | 143 to 317 |
| Cellular Localization | Cytoplasm. Secreted and Cell membrane. |
| Tissue Specificity | Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. |
| Function | Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | ≤1.0 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 20 kDa |
| Purity | >95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at room temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |