Recombinant Human S100 alpha 6/PRA Protein

Target Information

Sequence	MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Sequence Similarities	Belongs to the S-100 family. Contains 2 EF-hand domains.
Amino Acids	1 to 90
Cellular Localization	Nucleus envelope. Cytoplasm. Cell membrane.
Function	May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Endotoxin Level	<0.1 Eu/μg
Protein Length	Full length protein
Molecular Weight	10 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.