Cat. No.: IBDP-530860
Size:
Online InquiryTarget Information
| Sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVC IDPKLKWIQEYLEKALNK |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 22 to 89 |
| Cellular Localization | Secreted. |
| Function | Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the Lyn kinase. Stimulates migration of monocytes through its receptor, CXCR4, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through Lyn kinase. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Protein Length | Full length protein |
| Molecular Weight | 8 kDa |
| Purity | >98% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |