Cat. No.: IBDP-530242
Size:
Online InquiryTarget Information
| Sequence | MGSSHHHHHHSSGLVPRGSHMSGKSFKAGVCPPKKSAQCLRYKKPECQSD WQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNF CEMDGQCKRDLKCCMGMCGKSCVSPVKA |
| Sequence Similarities | Contains 2 WAP domains. |
| Amino Acids | 26 to 132 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Mucous fluids. |
| Function | Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. May prevent elastase-mediated damage to oral and possibly other mucosal tissues. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | His |
| Protein Length | Full length protein |
| Molecular Weight | 14 kDa |
| Purity | ≥80% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |