Cat. No.: IBDP-530115
Size:
Online InquiryTarget Information
| Sequence | MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAP GDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGT FLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFEL LEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVL RDYLSSFPFQI |
| Sequence Similarities | Contains 1 SH2 domain. Contains 1 SOCS box domain. |
| Amino Acids | 1 to 211 |
| Tissue Specificity | Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes. |
| Function | SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival (By similarity). Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | His |
| Protein Length | Full length protein |
| Molecular Weight | 28 kDa |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |