Recombinant Human TGF alpha Protein

Target Information

Sequence	ENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVC HSGYVGARCEHADLLAVVAASQKKQ
Sequence Similarities	Contains 1 EGF-like domain.
Amino Acids	24 to 98
Cellular Localization	Cell membrane and Secreted > extracellular space.
Tissue Specificity	Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
Function	TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	17 kDa
Purity	≥95%
Active	Yes
Animal free	No
Nature	Recombinant
Application	Biological Activity, Cell Culture, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.