Recombinant Human TGF beta Receptor I (mutated T204D) Protein

Target Information

Sequence	RDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLVQRTIARDIV LQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRH ENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLA LSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAV RHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGL VFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPN RWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM
Sequence Similarities	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain.
Amino Acids	80 to 426
Cellular Localization	Membrane.
Tissue Specificity	Found in all tissues examined, most abundant in placenta and least abundant in brain and heart.
Function	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta.

Product Details

Product Type	Protein
Species	Human
Source	Baculovirus Infected Sf9 Cells
Tag	proprietary Tag
Modifications	mutated T204D
Protein Length	Protein fragment
Molecular Weight	66 kDa
Purity	>95%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, SDS-PAGE

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.