Recombinant Human TLR2 Protein

Target Information

Sequence	KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDF AGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV
Sequence Similarities	Belongs to the Toll-like receptor family. Contains 14 LRR (leucine-rich) repeats. Contains 1 TIR domain.
Amino Acids	121 to 220
Cellular Localization	Membrane.
Tissue Specificity	Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues.
Function	Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Tag	GST
Protein Length	Protein fragment
Animal free	No
Nature	Recombinant
Application	ELISA, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.