Cat. No.: IBDP-530143
Size:
Online InquiryTarget Information
Sequence | LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIH FIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL |
Sequence Similarities | Belongs to the Toll-like receptor family. Contains 22 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 TIR domain. |
Amino Acids | 351 to 450 |
Cellular Localization | Membrane. |
Tissue Specificity | Highly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis. |
Function | Participates in the innate immune response to microbial agents. Mediates detection of bacterial flagellins. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. |
Product Details
Product Type | Protein |
Species | Human |
Source | Wheat Germ |
Protein Length | Protein fragment |
Molecular Weight | 37 kDa |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | ELISA, SDS-PAGE, WB |
Storage & Handling
Shipping | Shipped with Dry Ice. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |