Cat. No.: IBDP-530142
Size:
Online InquiryTarget Information
| Sequence | LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPD VFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSF SGVSLFSLSTEGCDEEEV |
| Sequence Similarities | Belongs to the Toll-like receptor family. Contains 22 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 TIR domain. |
| Amino Acids | 517 to 634 |
| Cellular Localization | Membrane. |
| Tissue Specificity | Highly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis. |
| Function | Participates in the innate immune response to microbial agents. Mediates detection of bacterial flagellins. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Protein Length | Protein fragment |
| Molecular Weight | 39 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |