Cat. No.: IBDP-531267
Size:
Online InquiryTarget Information
| Sequence | QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSS AVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQIL HRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDH HHHHH |
| Sequence Similarities | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Amino Acids | 16 to 162 |
| Cellular Localization | Cell membrane. Cytoplasm. Sequestered in cytoplasmic vesicles in resting platelets. Transported to the cell surface after stimulation by thrombin. Soluble fragments can be released into the serum by proteolysis. |
| Tissue Specificity | Detected in platelets, monocytic leukemia and in T-cell leukemia. |
| Function | Cell surface receptor that may play a role in the innate and adaptive immune response. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | His |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 17 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |