Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human UBE2T Protein

Cat. No.: IBDP-531470

Size:

Target Information

Synonyms Ubiquitin-Conjugating Enzyme E2 T|||Cell Proliferation-Inducing Gene 50 Protein|||Ubiquitin Carrier Protein T|||Ubiquitin-Protein Ligase T|||UBE2T
Sequence MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 25-30 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.