Cat. No.: IBDP-530564
Size:
Online InquiryTarget Information
| Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR |
| Sequence Similarities | Belongs to the PDGF/VEGF growth factor family. |
| Amino Acids | 27 to 191 |
| Cellular Localization | Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. |
| Tissue Specificity | Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. |
| Function | Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Protein Length | Full length protein |
| Molecular Weight | 38 kDa |
| Purity | >98% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |