Recombinant IL-17F Protein

Target Information

Synonyms	Cytokine ML-1|||IL17F|||Interleukin-17F
Sequence	ARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA
Function	IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer. IL-17F Protein, Rat (sf9, His) is a recombinant rat IL-17F protein with His tag at the C-terminus and is expressed in sf9 insect cells. It consists of 153 amino acids (M1-A153).

Product Details

Product Type	Protein
Species	Rat
Source	Sf9 Insect Cells
Tag	His
Endotoxin Level	<1.0 Eu/µg
Molecular Weight	16.4 kDa
Purity	≥90%

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.