Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse Animal-Free SDF-1 alpha/CXCL12 Protein

Cat. No.: IBDP-530817

Size:

Target Information

Synonyms CXCL12|||Stromal cell-derived factor 1|||SDF-1|||12-O-tetradecanoylphorbol 13-acetate repressed protein 1|||TPAR1|||C-X-C motif chemokine 12|||Pre-B cell growth-stimulating factor|||PBSF|||Thymic lymphoma cell-stimulating factor|||TLSF|||Sdf1
Sequence MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Product Details

Product Type Protein
Species Mouse
Source E. coli
Tag His
Endotoxin Level <0.1 Eu/μg
Molecular Weight 8.97 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.