Cat. No.: IBDP-531531
Size:
Online InquiryTarget Information
| Synonyms | Tumor necrosis factor ligand superfamily member 13B|||B lymphocyte stimulator|||BLyS|||B-cell-activating factor|||BAFF|||Dendritic cell-derived TNF-like molecule|||TNF- and APOL-related leukocyte expressed ligand 1|||TALL-1 |
| Sequence | AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL |
| Function | BAFF/TNFSF13B, is the B cell-activating cytokine belonging to the tumor necrosis factor family. BAFF is involved in cancer immunity and is mainly expressed in myeloid cells. Its overexpression can lead to autoimmune diseases such as systemic lupus erythematosus (SLE). In addition, BAFF is also involved in adipogenesis, atherosclerosis, neuroinflammatory process and ischemia/reperfusion (I/R) injury . Mouse BAFF protein has two glycosylated domains and one transmembrane domain (48-68 a.a.), and can be cleaved into membrane-type peptide fragments and soluble peptide fragments. BAFF/TNFSF13B Protein, Mouse (HEK293, Fc) is the extracullar part of BAFF protein (A127-L309), produced in HEK293 cells with N-terminal mFc-tag. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | HEK 293 Cells |
| Tag | mFc |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 45-60 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |