Recombinant Mouse CCL25 Protein

Target Information

Sequence	QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVC GNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNST SVRSATLGHPRMVMMPRKTNN
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	24 to 144
Cellular Localization	Secreted.
Tissue Specificity	Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Function	Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1.

Product Details

Product Type	Protein
Species	Mouse
Source	E. coli
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	14 kDa
Purity	>95%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -80 °C.
Handling	Avoid freeze / thaw cycle.