Cat. No.: IBDP-531503
Size:
Online InquiryTarget Information
| Sequence | QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCY LVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIG LWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWN DISCSLKQKSVCQMKKINL |
| Sequence Similarities | Contains 1 C-type lectin domain. |
| Amino Acids | 70 to 238 |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed in dendritic cells, myeloid cells, B-cells and HL-60 cells (at protein level). TNF alpha, IL-1 alpha, and LPS, down-regulated expression at the surface of neutrophils (at protein level). Expressed preferentially in hematopoietic tissues. Expressed in peripheral blood leukocytes, neutrophils, moderate quantities in spleen, lymph node, and bone marrow, and at very low levels in thymus. Expressed in Ag-presenting cells (DC, monocytes, macrophages and B-cells), as well as on granulocytes. Expression was decreased in DC by signals inducing its maturation (e.g. CD40 ligand, LPS, and TNF alpha). |
| Function | May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Protein Length | Protein fragment |
| Molecular Weight | 40 kDa |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |