Cat. No.: IBDP-531271
Size:
Online InquiryTarget Information
| Sequence | NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSK SVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEG TPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPE AEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 27 to 201 |
| Cellular Localization | Cell membrane. Secreted. Also exists as a soluble form. |
| Tissue Specificity | Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow. |
| Function | Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | Mammalian |
| Tag | His |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 20 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |