Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse CXCL1/GRO alpha Protein

Cat. No.: IBDP-530481

Size:

Target Information

Sequence APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREA CLDPEAPLVQKIVQKMLKGVPK
Sequence Similarities Belongs to the intercrine alpha (chemokine CxC) family.
Amino Acids 25 to 96
Cellular Localization Secreted.
Function Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.

Product Details

Product Type Protein
Species Mouse
Source E. coli
Protein Length Full length protein
Molecular Weight 11 kDa
Purity >99%
Active Yes
Animal free No
Nature Recombinant
Application FuncS, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.