Cat. No.: IBDP-530481
Size:
Online InquiryTarget Information
Sequence | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREA CLDPEAPLVQKIVQKMLKGVPK |
Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
Amino Acids | 25 to 96 |
Cellular Localization | Secreted. |
Function | Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. |
Product Details
Product Type | Protein |
Species | Mouse |
Source | E. coli |
Protein Length | Full length protein |
Molecular Weight | 11 kDa |
Purity | >99% |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |