Cat. No.: IBDP-531233
Size:
Online InquiryTarget Information
| Synonyms | rMuDCIP-1/CXCL3|||C-X-C motif chemokine 3|||Dendritic cell inflammatory protein 1 |
| Sequence | AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
| Function | CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. DCIP-1/CXCL3 Protein, Mouse (P.pastoris) is produced in P.pastoris , and consists of 73 amino acids (A28-S100). |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | P. pastoris |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 9 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |