Cat. No.: IBDP-531229
Size:
Online InquiryTarget Information
| Sequence | AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEV CLNPQGPRLQIIIKKILKSGKSS |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 28 to 100 |
| Cellular Localization | Secreted. |
| Function | Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Protein Length | Full length protein |
| Molecular Weight | 8 kDa |
| Purity | >97% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |