Cat. No.: IBDP-531246
Size:
Online InquiryTarget Information
| Synonyms | Interleukin-17F|||IL-17F|||Cytokine ML-1|||Interleukin-24|||IL-24|||IL17F|||IL24 |
| Sequence | RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
| Function | IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer. IL-17F Protein, Mouse (133a.a, HEK293, His) is a recombinant mouse IL-17F protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 133 amino acids (R29-A161). |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 17-23 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |