Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse IL-22 Protein

Cat. No.: IBDP-531451

Size:

Target Information

Synonyms rMuIL-22|||Cytokine Zcyto 18|||IL-TIF
Sequence LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Function IL-22 Protein, Mouse plays a prominent role in epithelial regeneration and dampening of chronic inflammatory responses by protecting intestinal stem cells from immune-mediated tissue damage.

Product Details

Product Type Protein
Species Mouse
Source E. coli
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 14-17 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.