Cat. No.: IBDP-531451
Size:
Online InquiryTarget Information
| Synonyms | rMuIL-22|||Cytokine Zcyto 18|||IL-TIF |
| Sequence | LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
| Function | IL-22 Protein, Mouse plays a prominent role in epithelial regeneration and dampening of chronic inflammatory responses by protecting intestinal stem cells from immune-mediated tissue damage. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 14-17 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |