Recombinant Mouse IL-28A Protein

Target Information

Sequence	DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRC SSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPL HTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEA SVTSNLFRLLTRDLKCVANGDQCV
Sequence Similarities	Belongs to the IL-28/IL-29 family.
Amino Acids	20 to 193
Cellular Localization	Secreted.
Function	Cytokine with immunomodulatory activity. Up-regulates MHC class I antigen expression. Displays potent antiviral activity. Also displays antitumor activity. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Product Details

Product Type	Protein
Species	Mouse
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	20 kDa
Purity	≥95%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.