Cat. No.: IBDP-530533
Size:
Online InquiryTarget Information
| Synonyms | rMuIL-9|||Cytokine P40|||T-cell Growth Factor P40 |
| Sequence | QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP |
| Function | IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family. IL-9 Protein, Mouse (CHO) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | CHO Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 28-42 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |