Cat. No.: IBDP-530775
Size:
Online InquiryTarget Information
| Sequence | MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTF SGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYY DMNAANVGWNGSTFA |
| Sequence Similarities | Belongs to the MIF family. |
| Amino Acids | 1 to 115 |
| Cellular Localization | Secreted. Cytoplasm. Does not have a cleavable signal sequence and is secreted via a specialized, non-classical pathway. Secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens. |
| Function | Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Protein Length | Full length protein |
| Molecular Weight | 13 kDa |
| Purity | >96% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |