Recombinant Mouse MIP-3 beta/CCL19 Protein

Target Information

Sequence	GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLC APPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	26 to 108
Cellular Localization	Secreted.
Tissue Specificity	Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Function	May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Specifically binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes.

Product Details

Product Type	Protein
Species	Mouse
Source	HEK 293 Cells
Protein Length	Full length protein
Molecular Weight	9 kDa
Purity	≥95%
Active	No
Animal free	Yes
Nature	Recombinant
Application	HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.