Cat. No.: IBDP-531006
Size:
Online InquiryTarget Information
| Sequence | GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRC YGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRR NLWTYNPLYQYYPNFLC |
| Sequence Similarities | Belongs to the phospholipase A2 family. |
| Amino Acids | 21 to 137 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Heart, placenta and less abundantly, in lung. |
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle. |
Product Details
| Product Type | Protein |
| Species | Mouse |
| Source | E. coli |
| Tag | His |
| Protein Length | Full length protein |
| Molecular Weight | 16 kDa |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |