Recombinant Mouse SOCS1 Protein

Target Information

Sequence	MVARNQVAADNAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPA PGDTHFRTFRSHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVG TFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRETFDCLFE LLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVAAVGRENLARIPLNPV LRDYLSSFPFQI
Sequence Similarities	Contains 1 SH2 domain. Contains 1 SOCS box domain.
Amino Acids	1 to 212
Tissue Specificity	Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes.
Function	SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival (By similarity). Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2.

Product Details

Product Type	Protein
Species	Mouse
Source	E. coli
Tag	His
Protein Length	Full length protein
Molecular Weight	29 kDa
Purity	>85%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.