Recombinant Mouse TREM2 Protein

Target Information

Sequence	LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHG VWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREA EVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFP
Sequence Similarities	Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Amino Acids	19 to 168
Cellular Localization	Secreted and Cell membrane.
Tissue Specificity	Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.
Function	May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.

Product Details

Product Type	Protein
Species	Mouse
Source	HEK 293 Cells
Tag	Avi, Fc Tag
Protein Length	Protein fragment
Purity	≥90%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -80 °C.
Handling	Avoid freeze / thaw cycle.