Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Mouse Uteroglobin/SCGB1A1 Protein

Cat. No.: IBDP-531049

Size:

Target Information

Synonyms Uteroglobin|||Clara cell 17 kDa protein|||Clara cell phospholipid-binding protein|||CCPBP|||Clara cells 10 kDa secretory protein|||CC10|||PCB-binding protein|||Secretoglobin family 1A member 1|||Scgb1a1|||Cc10|||Ugb|||Utg
Sequence DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Product Details

Product Type Protein
Species Mouse
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 9.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.