Cat. No.: IBDP-530873
Size:
Online InquiryTarget Information
| Sequence | IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNE KRCLNPESEAIKSLLKAVSQRRSKRAP |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 22 to 98 |
| Cellular Localization | Secreted. |
| Function | Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | HEK 293 Cells |
| Endotoxin Level | ≤0.005 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 9 kDa |
| Purity | ≥95% |
| Active | No |
| Animal free | Yes |
| Nature | Recombinant |
| Application | HPLC, MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |