Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Rat CXCL5 Protein

Cat. No.: IBDP-531009

Size:

Target Information

Sequence APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKN QKDNVCLDPQAPLIKKVIQKILGSENKKTKRNALALVRSASTQ
Sequence Similarities Belongs to the intercrine alpha (chemokine CxC) family.
Cellular Localization Secreted.
Function Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

Product Details

Product Type Protein
Species Rat
Source E. coli
Protein Length Full length protein
Molecular Weight 10 kDa
Purity >97%
Active Yes
Animal free No
Nature Recombinant
Application FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.