Cat. No.: IBDP-530485
Size:
Online InquiryTarget Information
| Sequence | MPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Amino Acids | 9 to 154 |
| Cellular Localization | Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57. |
| Tissue Specificity | Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. |
| Function | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107). |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | E. coli |
| Endotoxin Level | ≤1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 16 kDa |
| Purity | >95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |