Recombinant Rat IL-4 Protein

Target Information

Sequence	CNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRV LRKFYFPRDVPPCLKNKSGVLGELRKLCRGVSGLNSLRSCTVNESTLTTL KDFLESLKSILRGKYLQSCTSMS
Sequence Similarities	Belongs to the IL-4/IL-13 family.
Amino Acids	25 to 147
Cellular Localization	Secreted.
Function	Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

Product Details

Product Type	Protein
Species	Rat
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	14 kDa
Purity	≥95%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	FuncS, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.