Recombinant Rat IL3 Protein

Target Information

Sequence	ISDRGSDAHHLLRTLDCRTIALEILVKLPVSGLNNSDDKANLRNSTLRRV NLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDD FKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
Sequence Similarities	Belongs to the IL-3 family.
Amino Acids	27 to 166
Cellular Localization	Secreted.
Tissue Specificity	Activated T-cells, mast cells, natural killer cells.
Function	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Product Details

Product Type	Protein
Species	Rat
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Purity	≥95%
Active	Yes
Animal free	Yes
Nature	Recombinant

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.