Cat. No.: IBDP-530899
Size:
Online InquiryTarget Information
| Synonyms | rRtCCL5, His|||C-C motif chemokine 5|||SIS-delta|||Small-inducible cytokine A5|||T-cell-specific protein RANTES|||Ccl5|||Scya5 |
| Sequence | HHHHHHSPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS |
| Function | RANTES/CCL5 Protein, Rat (His) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Rat (His) is a recombinant rat RANTES/CCL5 (S25-S92) protein expressed by E. coli with a His tag at the C-terminu. |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | E. coli |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 14 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |