Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Rat S100A8 Protein

Cat. No.: IBDP-530890

Size:

Target Information

Synonyms Protein S100-A8|||S100a8|||Calgranulin-A|||Chemotactic cytokine CP-10|||Leukocyte L1 complex light chain|||Migration inhibitory factor-related protein 8|||MRP-8|||Pro-inflammatory S100 cytokine|||S100 calcium-binding protein A8|||Caga|||Mrp8
Sequence MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Product Details

Product Type Protein
Species Rat
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 13.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.