Cat. No.: IBDP-530891
Size:
Online InquiryTarget Information
| Sequence | AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLK REKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPR GHDHSHGKGCGK |
| Sequence Similarities | Belongs to the S-100 family. Contains 2 EF-hand domains. |
| Amino Acids | 2 to 113 |
| Cellular Localization | Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation. |
| Tissue Specificity | Expressed by macrophages in acutely inflammed tissues and in chronic inflammation. Detected in peripheral blood leukocytes, in neutrophils and granulocytes. Detected at sites of vascular inflammation (at protein level). Also expressed in epithelial cells constitutively or induced during dermatoses. |
| Function | Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as a pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions. |
Product Details
| Product Type | Protein |
| Species | Rat |
| Source | E. coli |
| Tag | His |
| Protein Length | Full length protein |
| Molecular Weight | 29 kDa |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |