Cat. No.: IBDP-532887
Size:
Online InquiryTarget Information
| Sequence | SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT |
| Function | Super-TDU (1-31) is a peptide fragment of Super-TDU. Super-TDU (1-31) is an inhibitor of YAP-TEAD complex. Super-TDU shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 3241.48 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |