Tat-peptide 190-208 TFA

Target Information

Sequence

YGNKKNNQNNNVAEPEPDPEPEPEQEPVSE

Function

Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms.

Product Details

Product Type	Peptide
Molecular Weight	3507.47 kDa
Purity	0.9762

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.