Cat. No.: IBDP-532923
Size:
Online InquiryTarget Information
| Sequence | DDSGTFYDQAVVSNDMEEHLEEPYGNKKNNQNNN |
| Function | Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 3916.97 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |