Cat. No.: IBDA-430096
Size:
Online InquiryTarget Information
| Target Name | TJP1/ZO‑1 |
| Synonyms | TJP1 | ZO-1 | Zona occludens protein 1 | Zona occludens 1 | Zonula occludens protein 1 | Tight junction protein 1 | ZO1 | Tight junction protein ZO-1 | Zonula occludens 1 protein |
| Uniprot ID | Q07157 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of human TJP1 (NP_003248.3). PKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMC. |
Product Details
| Description | ZO-1 antibody is an unconjugated rabbit polyclonal antibody to ZO-1 (TJP1) from human. |
| Host Species | Rabbit |
| Clonality | Polyclonal |
| Purity | Affinity purified |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
| Reactivity | Mouse, Human |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of human TJP1 (NP_003248.3). PKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMC. |
| Application | WB |
Storage & Handling
| Shipping | Shipped on dry ice. |
| Storage | Store at -20 °C |
| Storage Buffer | PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol |
| Handling | Avoid freeze-thaw cycles. |