Cat. No.: IBDA-431376
Size:
Online InquiryTarget Information
| Target Name | TLR8 |
| Uniprot ID | Q9NR97 |
| Cellular Localization | Membrane. |
| Immunogen | Synthetic peptide: CESFQGLQNLTKINLNHNPNVQHQNGNPGI , corresponding to amino acids 81-109 of Human TLR8. |
| Function | Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. |
Product Details
| Description | Goat polyclonal antibody to TLR8. |
| Host Species | Goat |
| Clonality | Polyclonal |
| Purity | Immunogen affinity purified |
| Isotype | IgG |
| Conjugation | Unconjugated |
| Reactivity | Mouse, Human |
| Immunogen | Synthetic peptide: CESFQGLQNLTKINLNHNPNVQHQNGNPGI , corresponding to amino acids 81-109 of Human TLR8. |
| Application | IHC-P |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Short term: 4 °C. Long term: -20 °C |
| Storage Buffer | pH: 7.20 Preservative: 0.1% Sodium Azide Constituent: 0.1% BSA, 0.21% Potassium Phosphate, 0.812% Sodium Chloride, PBS |
| Handling | Avoid freeze-thaw cycles. |