Urotensin I

Cat. No.: IBDI-438267

Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.

Product Details

Target	CRFR
Molecular Weight	4869.46
Synonyms	Catostomus urotensin I
Sequence	Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
Sequence Shortening	NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.