Cat. No.: IBDP-533003
Size:
Online InquiryTarget Information
| Synonyms | Vasoactive Intestinal Peptide, guinea pig TFA |
| Sequence | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
| Function | VIP Guinea pig TFA (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 3458.88 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |