Cat. No.: DPP-001039
Product Overview | |
---|---|
Species | Human |
Expression System | Wheat germ |
Format | Liquid |
Purity | ≥ 98% by HPLC |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | HCRTR2 |
UniProt No. | O43614 |
Gene ID | 3062 |
Molecular Weight | 32 kDa including tags |
Alternative Names | Hcr tr2; Hcrt receptor 2; Hcrtr2; Hypocretin (orexin) receptor 2; Hypocretin receptor 2; Hypocretin receptor type 2; Orexin 2 receptor; Orexin A/Orexin B receptor; Orexin receptor 2; Orexin receptor type 2; Orexin type 2 receptor; Ox-2-R; Ox2-R; Ox2r; OX2R_HUMAN; Type 2 hypocretin receptor; Type 2 orexin receptor |
Function | Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. |
Cellular Localization | Cell membrane. |
Protein Length | Protein fragment |
Sequence | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHP KEYE,Belongs to the G-protein coupled receptor 1 family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.